DATASHEET ISL32600E, ISL32601E, ISL32602E, ISL32603E FN7967 Rev.2.00 Jan 31, 2019 1.8V to 3.3V, Micro-Power, 15kV ESD, +125 C, Slew Rate Limited RS-485/RS-422 Transceivers The ISL32600E, ISL32601E, ISL32602E, and ISL32603E are 15kV IEC61000 ESD protected, micro-power, wide supply range transceivers for differential communication. The ISL32600E and ISL32601E operate with VCC 2.7V and have maximum supply currents as low as 100A with both the transmitter (Tx) and receiver (Rx) enabled. The ISL32602E and ISL32603E operate with supply voltages as low as 1.8V. These transceivers have very low bus currents, so they present less than a 1/8 unit load to the bus. This allows more than 256 transmitters on the network without violating the RS-485 specification's 32 unit load maximum. Features The Rx inputs feature symmetrical switching thresholds and up to 65mV of hysteresis to improve noise immunity and to reduce duty cycle distortion in the presence of slow moving input signals (see Figure 39 on page 18). The Rx input common-mode range is the full -7V to +12V RS-485 range for supply voltages 3V. * Symmetrical switching thresholds for less duty cycle distortion (see Figure 39 on page 18) Hot plug circuitry ensures that the Tx and Rx outputs remain in a high impedance state while the power supply stabilizes. * 1/8 unit load allows up to 256 devices on the bus This transceiver family uses slew rate limited drivers, which reduce EMI, and minimize reflections from improperly terminated transmission lines or from unterminated stubs in multidrop and multipoint applications. * Half and full duplex pinouts; three state Rx and Tx outputs The ISL32600E and ISL32602E are configured for full duplex (separate Rx input and Tx output pins) applications. The ISL32601E and ISL32603E are half duplex versions that multiplex the Rx inputs and Tx outputs to allow transceivers with output disable functions in 8 Ld packages. Table 1 on page 3 provides a summary of each device's features. Related Literature * Single 1.8V, 3V, or 3.3V supply * Low supply currents - ISL32601E . . . . . . . . . . . . . . . . . . 100A (maximum) at 3V - ISL32603E . . . . . . . . . . . . . . . . 150A (maximum) at 1.8V * Ultra low shutdown supply current. . . . . . . . . . . . . . . . . . 10nA * IEC61000 ESD protection on RS-485 I/O pins. . . . . . . 15kV - Class 3 ESD levels on all other pins. . . . . . . . . . >8kV HBM * Up to 65mV hysteresis for improved noise immunity * Data rates from 128kbps to 460kbps * Specified for +125C operation * -7V to +12V common-mode input/output voltage range (VCC 3V) * 5V tolerant logic inputs * Tiny MSOP packages consume 50% less board space Applications * Differential sensor interfaces * Process control networks * Security camera networks * Building environmental control/lighting systems For a full list of related documents, visit our website: * ISL32600E, ISL32601E, ISL32602E, and ISL32603E device pages 10m ISL3172E DYNAMIC (9.6kbps) 25C, RD = , CD = 50pF ISL3172E STATIC ISL3260xE DYNAMIC (9.6kbps) ICC (A) ICC (A) DYNAMIC (256kbps) DE = VCC, RE = GND 1m 100 DYNAMIC (128kbps) 1m ISL3260xE STATIC STATIC DE = VCC, RE = GND 10 2.7 2.8 2.9 3 25C, RD = , CD = 50pF 3.1 3.2 3.3 3.4 3.5 SUPPLY VOLTAGE (V) FIGURE 1. THE ISL32600E AND ISL32601E HAVE A 9.6kbps OPERATING ICC LOWER THAN THE STATIC ICC OF MANY EXISTING 3V TRANSCEIVERS FN7967 Rev.2.00 Jan 31, 2019 3.6 100 1.8 2.0 2.2 2.4 2.6 2.8 3.0 3.2 3.4 3.6 SUPPLY VOLTAGE (V) FIGURE 2. THE ISL32602E AND ISL32603E WITH VCC = 1.8V REDUCE OPERATING ICC BY A FACTOR OF 25 TO 40, COMPARED WITH ICC AT VCC = 3.3V Page 1 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Operating Circuits 1.8V 8 R PU 1.8V 100nF V CC 100nF 1.8V RB 1 RO 8 R PU V CC RO 1 A/Y 6 6 A/Y 2 RE RE 2 3 DE B/Z 7 R T2 V FS R T1 DE 3 7 B/Z 4 DI } Note 14 } Note 14 DI 4 RB GND 5 GND 5 FIGURE 3. HALF DUPLEX NETWORK USING ISL32603E (PIN NUMBERS FOR SOIC) 3 .3 V 100nF 13, 14 R PU VCC 100nF RB A 12 11 2 RO 3 RE B 4 DE Z 10 5 DI Y 3 .3 V RB 9 RT VFS VFS 9 RT R PU DI 5 10 Z DE 4 11 B RE 3 RO 2 12 A GND 6, 7 Y 1 3, 1 4 VCC GND RB RB 6, 7 FIGURE 4. FULL DUPLEX NETWORK USING ISL32600E NOTE: For calculating the resistor values see TB509, "Detecting Bus Signals Correctly with Failsafe Biased RS-485 Receivers". FN7967 Rev.2.00 Jan 31, 2019 Page 2 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Ordering Information PART NUMBER (Notes 2, 3) PART MARKING TEMP. RANGE (C) TAPE AND REEL (Units) (Note 1) PACKAGE (RoHS Compliant) PKG. DWG. # ISL32600EFBZ 32600EFBZ -40 to +125 - 14 Ld SOIC M14.15 ISL32600EFBZ-T 32600EFBZ -40 to +125 2.5k 14 Ld SOIC M14.15 ISL32600EFBZ-T7A 32600EFBZ -40 to +125 250 14 Ld SOIC M14.15 ISL32600EFUZ 32600 -40 to +125 - 10 Ld MSOP M10.118 ISL32600EFUZ-T 32600 -40 to +125 2.5k 10 Ld MSOP M10.118 ISL32600EFUZ-T7A 32600 -40 to +125 250 10 Ld MSOP M10.118 ISL32601EFBZ 32601 EFBZ -40 to +125 - 8 Ld SOIC M8.15 ISL32601EFBZ-T 32601 EFBZ -40 to +125 2.5k 8 Ld SOIC M8.15 ISL32601EFBZ-T7A 32601 EFBZ -40 to +125 250 8 Ld SOIC M8.15 ISL32601EFUZ 32601 -40 to +125 - 8 Ld MSOP M8.118 ISL32601EFUZ-T 32601 -40 to +125 2.5k 8 Ld MSOP M8.118 ISL32601EFUZ-T7A 32601 -40 to +125 250 8 Ld MSOP M8.118 ISL32602EFBZ 32602EFBZ -40 to +125 - 14 Ld SOIC M14.15 ISL32602EFBZ-T 32602EFBZ -40 to +125 2.5k 14 Ld SOIC M14.15 ISL32602EFBZ-T7A 32602EFBZ -40 to +125 250 14 Ld SOIC M14.15 ISL32602EFUZ 32602 -40 to +125 - 10 Ld MSOP M10.118 ISL32602EFUZ-T 32602 -40 to +125 2.5k 10 Ld MSOP M10.118 ISL32602EFUZ-T7A 32602 -40 to +125 250 10 Ld MSOP M10.118 ISL32603EFBZ 32603 EFBZ -40 to +125 - 8 Ld SOIC M8.15 ISL32603EFBZ-T 32603 EFBZ -40 to +125 2.5k 8 Ld SOIC M8.15 ISL32603EFBZ-T7A 32603 EFBZ -40 to +125 250 8 Ld SOIC M8.15 ISL32603EFUZ 32603 -40 to +125 - 8 Ld MSOP M8.118 ISL32603EFUZ-T 32603 -40 to +125 2.5k 8 Ld MSOP M8.118 ISL32603EFUZ-T7A 32603 -40 to +125 250 8 Ld MSOP M8.118 NOTES: 1. See TB347 for details about reel specifications. 2. These Pb-free plastic packaged products employ special Pb-free material sets, molding compounds/die attach materials, and 100% matte tin plate plus anneal (e3 termination finish, which is RoHS compliant and compatible with both SnPb and Pb-free soldering operations). Pb-free products are MSL classified at Pb-free peak reflow temperatures that meet or exceed the Pb-free requirements of IPC/JEDEC J STD-020. 3. For Moisture Sensitivity Level (MSL), see the ISL32600E, ISL32601E, ISL32602E, and ISL32603E device information pages. For more information about MSL, see TB363. TABLE 1. SUMMARY OF FEATURES PART NUMBER SUPPLY RANGE (V) HALF/FULL DUPLEX DATA RATE (kbps) SLEW-RATE LIMITED? HOT PLUG? # DEVICES ON BUS RX/TX ENABLE? QUIESCENT ICC (A) LOW POWER SHUTDOWN? PIN COUNT ISL32600E 2.7 to 3.6 FULL 128 - 256 YES YES 256 YES 60 at 3V YES 10, 14 ISL32601E 2.7 to 3.6 HALF 128 - 256 YES YES 256 YES 60 at 3V YES 8 ISL32602E 1.8 to 3.6 FULL 256 - 460 YES YES 256 YES 105 at 1.8V YES 10, 14 ISL32603E 1.8 to 3.6 HALF 256 - 460 YES YES 256 YES 105 at 1.8V YES 8 FN7967 Rev.2.00 Jan 31, 2019 Page 3 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Pin Configurations ISL32600E, ISL32602E (10 LD MSOP) TOP VIEW ISL32601E, ISL32603E (8 LD MSOP, SOIC) TOP VIEW RO 1 R RE 2 DE 3 DI 4 D 8 VCC RO 1 7 B/Z RE 2 6 A/Y DE 3 5 GND DI 4 R 10 VCC 9 A 8 B D GND 5 7 Z 6 Y ISL32600E, ISL32602E (14 LD SOIC) TOP VIEW NC 1 14 VCC RO 2 RE 3 13 NC R 11 B DE 4 DI 5 12 A D 10 Z GND 6 9 Y GND 7 8 NC Pin Descriptions PIN 8 LD 10 LD 14 LD PACKAGE PACKAGE PACKAGE FUNCTION RO 1 1 2 Receiver output: If A-B 200mV, RO is high; if A-B -200mV, RO is low; if A and B are unconnected (floating), RO = high. RE 2 2 3 Receiver output enable. RO is enabled when RE is low; RO is high impedance when RE is high. If the Rx enable function is not required, connect RE directly to GND. DE 3 3 4 Driver output enable. The driver outputs, Y and Z, are enabled by bringing DE high, and are high impedance when DE is low. If the Tx enable function is not required, connect DE to VCC. DI 4 4 5 Driver input. A low on DI forces output Y low and output Z high. Similarly, a high on DI forces output Y high and output Z low. GND 5 5 6, 7 A/Y 6 - - 15kV IEC61000 ESD protected RS-485/422 level, noninverting receiver input and noninverting driver output. Pin is an input if DE = 0; pin is an output if DE = 1. B/Z 7 - - 15kV IEC61000 ESD protected RS-485/422 level, inverting receiver input and inverting driver output. Pin is an input if DE = 0; pin is an output if DE = 1. A - 9 12 15kV IEC61000 ESD protected RS-485/422 level, noninverting receiver input. B - 8 11 15kV IEC61000 ESD protected RS-485/422 level, inverting receiver input. Y - 6 9 15kV IEC61000 ESD protected RS-485/422 level, noninverting driver output. Z - 7 10 15kV IEC61000 ESD protected RS-485/422 level, inverting driver output. VCC 8 10 14 System power supply input (2.7V to 3.6V for the ISL32600E and ISL32601E; 1.8V to 3.6V for the ISL32602E and ISL32603E). NC - - 1, 8, 13 FN7967 Rev.2.00 Jan 31, 2019 Ground connection. No internal connection. Page 4 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Truth Tables Truth Tables (continued) TRANSMITTING RECEIVING INPUTS OUTPUTS INPUTS RE DE DI Z Y X 1 1 0 1 X 1 0 1 0 0 0 X High-Z High-Z 1 0 X High-Z * High-Z * NOTE: *Shutdown Mode (See Note 11). RE OUTPUT DE DE Half Duplex Full Duplex A-B RO VAB 0.2V 1 0 0 X 0 0 X 0 0 X VAB -0.2V 0 0 0 X Inputs Open 1 1 0 0 X High-Z * 1 1 1 X High-Z 0.2V > VAB > -0.2V Undetermined NOTE: *Shutdown Mode (See Note 11). FN7967 Rev.2.00 Jan 31, 2019 Page 5 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Absolute Maximum Ratings Thermal Information VCC to GND . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7V Input Voltages DI, DE, RE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -0.3V to 7V Input/Output Voltages A, B, . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -8V to +13V A/Y, B/Z, Y, Z (VCC = 0V or 3V) . . . . . . . . . . . . . . . . . . . . . . . -8V to +13V A/Y, B/Z, Y, Z (1.8V VCC < 3V) . . . . . . . . . . . . . . . . . . . . . . . -8V to +11V RO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -0.3V to (VCC +0.3V) Short-Circuit Duration Y, Z. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Indeterminate ESD Rating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . See Specification Table Latch-Up (per JESD78, Level 2, Class A). . . . . . . . . . . . . . . . . . . . . . +125C Thermal Resistance (Typical, Notes 4, 5) JA (C/W) JC (C/W) 8 Ld SOIC Package . . . . . . . . . . . . . . . . . . . . 105 47 8 Ld MSOP Package . . . . . . . . . . . . . . . . . . . 140 40 10 Ld MSOP Package . . . . . . . . . . . . . . . . . . 160 59 14 Ld SOIC Package . . . . . . . . . . . . . . . . . . . 128 39 Maximum Junction Temperature (Plastic Package) . . . . . . . . . . . +150C Maximum Storage Temperature Range . . . . . . . . . . . . . -65C to +150C Pb-Free Reflow Profile. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . see TB493 Recommended Operating Conditions Supply Voltage Range ISL32600E, ISL32601E . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3V to 3.3V ISL32602E, ISL32603E . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.8V to 3.3V Differential Load Resistance ISL32600E, ISL32601E . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 or 120 ISL32602E, ISL32603E . . . . . . . . . . . . . . 10k at 1.8V; 120 at 3.3V Common-Mode Range ISL32600E, ISL32601E . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -7V to +12V ISL32602E, ISL32603E VCC = 1.8V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -2V to +2V VCC = 3.3V . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -7V to +12V Temperature Range. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . -40C to +125C CAUTION: Do not operate at or near the maximum ratings listed for extended periods of time. Exposure to such conditions can adversely impact product reliability and result in failures not covered by warranty. NOTES: 4. JA is measured with the component mounted on a high-effective thermal conductivity test board in free air. See TB379 for details. 5. For JC, the "case temp" location is taken at the package top center. ISL32600E, ISL32601E Electrical Specifications Test Conditions: VCC = 2.7V to 3.6V; typical values are at VCC = 3V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) MAX (Note 15) TEMP (C) MIN (Note 15) RL = 100 (RS-422) (Figure 5A, VCC 3.15V) Full 1.95 2.1 - V RL = 54 (RS-485) (Figure 5A) VCC = 2.7V Full 1.2 1.5 VCC V VCC 3V Full 1.4 1.7 VCC V No Load Full - - VCC V RL = 60, -7V VCM 12V (Figure 5B, VCC 3V) Full 1.3 - - V VOD RL = 54 or 100 (Figure 5A) Full - 0.01 0.2 V Driver Common-Mode VOUT VOC RL = 54 or 100 (Figure 5A) Full - - 3 V Change in Magnitude of Driver Common-Mode VOUT for Complementary Output States VOC RL = 54 or 100 (Figure 5A) Full - 0.01 0.2 V Output Leakage Current (Y, Z) (Full Duplex Versions Only) IOZD DE = 0V, VCC = 0V (-7V VIN 12V) or 2.7V VCC 3.6V PARAMETER SYMBOL TEST CONDITIONS TYP UNIT DC CHARACTERISTICS Driver Differential VOUT Change in Magnitude of Driver Differential VOUT for Complementary Output States VOD VIN = 12V (VCC 3V) Full - 3 60 A VIN = 10V (VCC = 2.7V) Full - 3 60 A VIN = -7V Full -30 -10 - A - 250 mA Driver Short-Circuit Current, VO = High or Low IOSD DE = VCC, -7V VY or VZ 12V (Note 8) Full - Logic Input High Voltage VIH DI, DE, RE Full 2 - - V Logic Input Low Voltage VIL DI, DE, RE Full - - 0.7 V FN7967 Rev.2.00 Jan 31, 2019 Page 6 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E ISL32600E, ISL32601E Electrical Specifications Test Conditions: VCC = 2.7V to 3.6V; typical values are at VCC = 3V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) (Continued) PARAMETER SYMBOL TEMP (C) MIN (Note 15) TYP MAX (Note 15) UNIT Full -1 - 1 A VIN = 12V (VCC 2.7V for A, B) Full - 80 125 A VIN = 12V (VCC 3V for A/Y, B/Z) Full - 80 125 A VIN = 10V (VCC = 2.7V for A/Y, B/Z) Full - 80 125 A VIN = -7V Full -100 -50 - A TEST CONDITIONS Logic Input Current IIN1 DI = DE = RE = 0V or VCC (Note 14) Input Current (A, B, A/Y, B/Z) IIN2 DE = 0V, VCC = 0V (-7V VIN 12V) or 2.7V VCC 3.6V Receiver Differential Threshold Voltage V TH -7V VCM 12V Full -200 0 200 mV Receiver Input Hysteresis V TH -7V VCM 12V Full - 40 - mV Receiver Output High Voltage VOH IO = -4mA, VID = 200mV Full VCC - 0.5 - - V Receiver Output Low Voltage VOL IO = 4mA, VID = -200mV Full - - 0.4 V Three-State (High Impedance) Receiver Output Current IOZR 0V VO VCC, RE = VCC Full -1 - 1 A Receiver Short-Circuit Current IOSR 0V VO VCC Full - 30 60 mA VCC = 3V Full - 60 100 A VCC = 3.6V Full - 70 120 A DI = 0V or VCC, Rx Only VCC = 3V (DE = 0V, RE = 0V) VCC = 3.6V Full - 42 65 A Full - 46 80 A DE = 0V, RE = VCC, DI = 0V or VCC Full - 0.01 1 A IEC61000-4-2, Air-Gap Discharge Method 25 - 15 - kV IEC61000-4-2, Contact Discharge Method 25 - 8 - kV Human Body Model, from Bus Pins to GND 25 - 15 - kV HBM, per MIL-STD-883 Method 3015 25 - 8 - kV Machine Model 25 - 400 - V VCC = 2.7V Full 128 - - kbps VCC 3V Full 256 - - kbps SUPPLY CURRENT No-Load Supply Current (Note 7) Shutdown Supply Current ICC ISHDN DI = 0V or VCC, DE = VCC, RE = 0V or VCC ESD PERFORMANCE RS-485 Pins (A, Y, B, Z, A/Y, B/Z) All Pins SWITCHING CHARACTERISTICS Maximum Data Rate fMAX RDIFF = 54, (Figures 8, 9) Driver Differential Output Delay tDD RDIFF = 54, CD = 50pF (Figure 6) Full - 340 600 ns Driver Differential Output Skew tSKEW RDIFF = 54, CD = 50pF (Figure 6) Full - 1 30 ns Driver Differential Rise or Fall Time tR, tF RDIFF = 54, CD = 50pF (Figure 6) Full 200 400 1000 ns Driver Enable to Output High tZH RL = 1k, CL = 50pF, SW = GND (Figure 7), (Note 9) Full - - 1000 ns Driver Enable to Output Low tZL RL = 1k, CL = 50pF, SW = VCC (Figure 7), (Note 9) Full - - 1000 ns Driver Disable from Output High tHZ RL = 1k, CL = 50pF, SW = GND (Figure 7) Full - - 150 ns Driver Disable from Output Low tLZ RL = 1k, CL = 50pF, SW = VCC (Figure 7) Full - - 150 ns Driver Enable from Shutdown to Output High tZH(SHDN) RL = 1k, CL = 50pF, SW = GND (Figure 7), (Notes 11, 12) Full - - 10 s FN7967 Rev.2.00 Jan 31, 2019 Page 7 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E ISL32600E, ISL32601E Electrical Specifications Test Conditions: VCC = 2.7V to 3.6V; typical values are at VCC = 3V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) (Continued) TEMP (C) MIN (Note 15) TYP MAX (Note 15) UNIT RL = 1k, CL = 50pF, SW = VCC (Figure 7), (Notes 11, 12) Full - - 10 s tSHDN (Note 11) Full 50 - 600 ns Receiver Input to Output Delay tPLH, tPHL (Figure 9) Full - 750 1300 ns Receiver Skew | tPLH - tPHL | tSKD (Figure 9) Full - 115 300 ns PARAMETER Driver Enable from Shutdown to Output Low Time to Shutdown SYMBOL tZL(SHDN) TEST CONDITIONS Receiver Enable to Output High tZH RL = 1k, CL = 15pF, SW = GND (Figure 10), (Note 10) Full - - 50 ns Receiver Enable to Output Low tZL RL = 1k, CL = 15pF, SW = VCC (Figure 10), (Note 10) Full - - 50 ns Receiver Disable from Output High tHZ RL = 1k, CL = 15pF, SW = GND (Figure 10) Full - 12 50 ns Receiver Disable from Output Low tLZ RL = 1k, CL = 15pF, SW = VCC (Figure 10) Full - 13 50 ns Receiver Enable from Shutdown to Output High tZH(SHDN) RL = 1k, CL = 15pF, SW = GND (Figure 10), (Notes 11, 13) Full - - 12 s Receiver Enable from Shutdown to Output Low tZL(SHDN) RL = 1k, CL = 15pF, SW = VCC (Figure 10), (Notes 11, 13) Full - - 12 s ISL32602E, ISL32603E Electrical Specifications Test Conditions: VCC = 1.8V to 3.6V; Typical values are at VCC = 1.8V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) PARAMETER SYMBOL TEST CONDITIONS TEMP MIN (C) (Note 15) TYP MAX (Note 15) UNIT DC CHARACTERISTICS Driver Differential VOUT VCC = 1.8V Full 0.8 0.9 - V VCC 3.15V Full 1.95 2.25 - V No Load, VCC = 1.8V Full 1.1 1.4 VCC RL = 54 (RS-485) (Figure 5A, VCC 3V) Full 1.5 1.95 - V RL = 60, -7V VCM 12V (Figure 5B, VCC 3V) Full 1.3 - - V VOD RL = 100 (Figure 5A) Full - 0.01 0.2 V VOC RL = 100 (Figure 5A) Full - - 3 V Change in Magnitude of Driver Common-Mode VOUT for Complementary Output States VOC RL = 100 (Figure 5A) Full - 0.01 0.2 V Output Leakage Current (Y, Z) (Full Duplex Versions Only) IOZD DE = 0V, VCC = 0V (-7V VIN 12V) or 1.8V or 3V VCC 3.6V Change in Magnitude of Driver Differential VOUT for Complementary Output States Driver Common-Mode VOUT VOD RL = 100 (RS-422) (Figure 5A) VOUT = 12V (VCC 3V) Full - 1 60 A VOUT = 10V (VCC = 1.8V) Full - 1 60 A VOUT = -7V Full -30 -10 - A Full - - 250 mA VCC 1.8V Full 1.26 - - V VCC 3V Full 2 - - V VCC 1.8V Full - - 0.4 V VCC 3V Full - - 0.8 V Full -1 - 1 A Driver Short-Circuit Current, VO = High or Low IOSD DE = VCC, -7V VY or VZ 12V (3.0V VCC 3.6V) or -7V VY or VZ 10V (VCC = 1.8V) (Note 8) Logic Input High Voltage VIH DI, DE, RE Logic Input Low Voltage Logic Input Current FN7967 Rev.2.00 Jan 31, 2019 VIL IIN1 DI, DE, RE DI = DE = RE = 0V or VCC (Note 14) Page 8 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E ISL32602E, ISL32603E Electrical Specifications Test Conditions: VCC = 1.8V to 3.6V; Typical values are at VCC = 1.8V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) (Continued) PARAMETER Input Current (A, B, A/Y, B/Z) SYMBOL IIN2 TEST CONDITIONS DE = 0V, VCC = 0V (-7V VIN 12V) or 1.8V or 3V VCC 3.6V TEMP MIN (C) (Note 15) TYP MAX (Note 15) UNIT VIN = 12V (A, B Only) Full - 80 125 A VIN = 12V (VCC 3V for A/Y, B/Z) Full - 80 125 A VIN = 10V (VCC = 1.8V for A/Y, B/Z) Full - 80 125 A VIN = -7V Full -100 -50 - A Receiver Differential Threshold Voltage V TH -7V VY or VZ 2V at VCC = 1.8V or -7V VY or VZ 12V at VCC 3V Full -200 0 200 mV Receiver Input Hysteresis V TH -7V VY or VZ 2V at VCC = 1.8V or -7V VY or VZ 12V at VCC 3V Full - 65 - mV Receiver Output High Voltage VOH IO = -1mA, VID = 200mV Full VCC - 0.4 - - V Receiver Output Low Voltage VOL IO = 2.2mA, VID = -200mV Full - - 0.4 V Three-State (High Impedance) Receiver Output Current IOZR 0V VO VCC, RE = VCC Full -1 - 1 A Receiver Short-Circuit Current IOSR 0V VO VCC Full - - 60 mA VCC = 1.8V Full - 105 150 A VCC = 3.6V Full - 150 350 A DI = 0V or VCC, Rx Only VCC = 1.8V (DE = 0V, VCC = 3.6V RE = 0V) Full - 90 115 A Full - 125 260 A DE = 0V, RE = VCC, DI = 0V or VCC Full - - 1 A IEC61000-4-2, Air-Gap Discharge Method 25 - 15 - kV IEC61000-4-2, Contact Discharge Method 25 - 8 - kV Human Body Model, from Bus Pins to GND 25 - 15 - kV HBM, per MIL-STD-883 Method 3015 25 - 8 - kV Machine Model 25 - 400 - V VCC = 1.8V, RDIFF = Full 256 - - kbps VCC 3V, RDIFF = 54 Full 460 - - kbps VCC = 1.8V, RDIFF = Full - 750 2600 ns VCC 3V, RDIFF = 54 Full - 350 1500 ns VCC = 1.8V, RDIFF = Full - 120 220 ns VCC 3V, RDIFF = 54 Full - 2 100 ns VCC = 1.8V, RDIFF = Full 150 1700 4500 ns VCC 3V, RDIFF = 54 Full 200 400 900 ns SUPPLY CURRENT No-Load Supply Current (Note 7) Shutdown Supply Current ICC ISHDN DI = 0V or VCC, DE = VCC, RE = 0V or VCC ESD PERFORMANCE RS-485 Pins (A, Y, B, Z, A/Y, B/Z) All Pins SWITCHING CHARACTERISTICS Maximum Data Rate Driver Differential Output Delay Driver Differential Output Skew Driver Differential Rise or Fall Time fMAX tDD tSKEW tR, tF (Figure 8, 9) CD = 50pF (Figure 6) CD = 50pF (Figure 6) CD = 50pF (Figure 6) Driver Enable to Output High tZH RL = 1k, CL = 50pF, SW = GND (Figure 7), (Note 9) Full - - 3000 ns Driver Enable to Output Low tZL RL = 1k, CL = 50pF, SW = VCC (Figure 7), (Note 9) Full - - 3000 ns Driver Disable from Output High tHZ RL = 1k, CL = 50pF, SW = GND (Figure 7) Full - - 250 ns Driver Disable from Output Low tLZ RL = 1k, CL = 50pF, SW = VCC (Figure 7) Full - - 250 ns FN7967 Rev.2.00 Jan 31, 2019 Page 9 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E ISL32602E, ISL32603E Electrical Specifications Test Conditions: VCC = 1.8V to 3.6V; Typical values are at VCC = 1.8V, TA = +25C; unless otherwise specified. Boldface limits apply across the operating temperature range. (Note 6) (Continued) PARAMETER SYMBOL TEST CONDITIONS TEMP MIN (C) (Note 15) TYP MAX (Note 15) UNIT Driver Enable from Shutdown to Output High tZH(SHDN) RL = 1k, CL = 50pF, SW = GND (Figure 7), (Notes 11, 12) Full - - 3000 ns Driver Enable from Shutdown to Output Low tZL(SHDN) RL = 1k, CL = 50pF, SW = VCC (Figure 7), (Notes 11, 12) Full - - 3000 ns tSHDN (Note 11) Full 50 500 1200 ns Receiver Input to Output Delay tPLH, tPHL (Figure 9) Full - 180 1000 ns Receiver Skew | tPLH - tPHL | tSKD (Figure 9) Full - 35 250 ns Receiver Enable to Output High tZH RL = 1k, CL = 15pF, SW = GND (Figure 10), (Note 10) Full - - 100 ns Receiver Enable to Output Low tZL RL = 1k, CL = 15pF, SW = VCC (Figure 10), (Note 10) Full - - 100 ns Receiver Disable from Output High tHZ RL = 1k, CL = 15pF, SW = GND (Figure 10) Full - - 75 ns Receiver Disable from Output Low tLZ RL = 1k, CL = 15pF, SW = VCC (Figure 10) Full - - 75 ns Receiver Enable from Shutdown to Output High tZH(SHDN) RL = 1k, CL = 15pF, SW = GND (Figure 10), (Notes 11, 13) Full - - 5500 ns Receiver Enable from Shutdown to Output Low tZL(SHDN) RL = 1k, CL = 15pF, SW = VCC (Figure 10), (Notes 11, 13) Full - - 5500 ns Time to Shutdown NOTES: 6. All currents into device pins are positive; all currents out of device pins are negative. All voltages are referenced to device ground unless otherwise specified. 7. Supply current specification is valid for loaded drivers when DE = 0V. 8. Applies to peak current. See "Typical Performance Curves" starting on page 13 for more information. 9. When testing this parameter, keep RE = 0 to prevent the device from entering SHDN. 10. When testing this parameter, the RE signal high time must be short enough (typically <100ns) to prevent the device from entering SHDN. 11. Devices are put into shutdown by bringing RE high and DE low. If the inputs are in this state for less than 50ns, the parts are assured not to enter shutdown. If the inputs are in this state for at least 600ns (1200ns if VCC = 1.8V), the parts are assured to have entered shutdown. See "Low Power Shutdown Mode" on page 19. 12. Keep RE = VCC, and set the DE signal low time >600ns (1200ns if VCC = 1.8V) to ensure that the device enters SHDN. 13. Set the RE signal high time >600ns (1200ns if VCC = 1.8V) to ensure that the device enters SHDN. 14. If the Tx or Rx enable function is not needed, connect the enable pin to the appropriate supply (see "Pin Descriptions" on page 4). 15. Compliance to datasheet limits is assured by one or more methods: production test, characterization, and/or design. FN7967 Rev.2.00 Jan 31, 2019 Page 10 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Test Circuits and Waveforms VCC RL/2 DE VCC Z DI Z DI VOD D 375 DE VOD D Y VCM RL = 60 -7V to +12V Y RL/2 VOC 375 FIGURE 5B. VOD WITH COMMON MODE LOAD FIGURE 5A. VOD AND VOC FIGURE 5. DC DRIVER TEST CIRCUITS VCC DI 50% 50% tDDLH tDDHL 0V DE VCC Z DI RDIFF D OUT (Z) VOH OUT (Y) VOL CD Y SIGNAL GENERATOR 90% DIFF OUT (Y - Z) +VOD 90% 10% 10% tR -VOD tF tSKEW = |tDDLH - tDDHL| FIGURE 6A. TEST CIRCUIT FIGURE 6B. MEASUREMENT POINTS FIGURE 6. DRIVER PROPAGATION DELAY AND DIFFERENTIAL TRANSITION TIMES DE Z DI 1k VCC D SIGNAL GENERATOR SW Y GND 50pF VCC DE Note 11 50% 0V tZH, tZH(SHDN) Note 11 PARAMETER OUTPUT RE DI SW tHZ Y/Z X 1/0 GND OUTPUT HIGH tHZ VOH - 0.25V 50% OUT (Y, Z) VOH 0V tLZ Y/Z X 0/1 VCC tZH Y/Z 0 (Note 9) 1/0 GND tZL, tZL(SHDN) Note 11 tZL Y/Z 0 (Note 9) 0/1 VCC OUT (Y, Z) tZH(SHDN) Y/Z 1 (Note 12) 1/0 GND tZL(SHDN) Y/Z 1 (Note 12) 0/1 VCC FIGURE 7A. TEST CIRCUIT 50% tLZ VCC 50% VOL + 0.25V V OUTPUT LOW OL FIGURE 7B. MEASUREMENT POINTS FIGURE 7. DRIVER ENABLE AND DISABLE TIMES FN7967 Rev.2.00 Jan 31, 2019 Page 11 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Test Circuits and Waveforms (Continued) VCC DE Z DI VCC - 0V VOD 50pF RDIFF D DI Y + SIGNAL GENERATOR +VOD DIFF OUT (Y - Z) -VOD 0V FIGURE 8B. MEASUREMENT POINTS FIGURE 8A. TEST CIRCUIT FIGURE 8. DRIVER DATA RATE +1V RE GND A 15pF B R A 0V 0V RO -1V tPLH tPHL VCC SIGNAL GENERATOR 50% RO 50% 0V FIGURE 9B. MEASUREMENT POINTS FIGURE 9A. TEST CIRCUIT FIGURE 9. RECEIVER PROPAGATION DELAY AND DATA RATE RE GND B A R Note 11 1k RO SW SIGNAL GENERATOR VCC VCC GND RE 50% 50% 0V 15pF tZH, tZH(SHDN) Note 11 PARAMETER DE A SW tHZ X +1.5V GND tLZ X -1.5V VCC tZH (Note 10) 0 +1.5V GND tZL (Note 10) 0 -1.5V VCC tZH(SHDN) (Note 13) 0 +1.5V GND tZL(SHDN) (Note 11) 0 -1.5V VCC FIGURE 10A. TEST CIRCUIT OUTPUT HIGH tHZ V VOH - 0.25V OH 1.5V RO 0V tZL, tZL(SHDN) Note 11 RO tLZ VCC 1.5V OUTPUT LOW VOL + 0.25V V OL FIGURE 10B. MEASUREMENT POINTS FIGURE 10. RECEIVER ENABLE AND DISABLE TIMES FN7967 Rev.2.00 Jan 31, 2019 Page 12 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Performance Curves VCC = 3V (ISL32600E, ISL32601E) or 1.8V (ISL32602E, ISL32603E), TA = +25C; unless otherwise specified 30 RECEIVER OUTPUT CURRENT (mA) DIFFERENTIAL OUTPUT VOLTAGE (V) 2.9 2.7 RDIFF = 10k 2.5 2.3 2.1 RDIFF = 100 1.9 1.7 RDIFF = 54 1.5 -40 -25 -10 5 20 35 50 65 80 95 20 VOL, +125C 15 VOL, +85C 10 5 0 -5 VOH, +85C -10 VOH, +125C -15 -20 110 125 VOL, +25C 25 VOH, +25C 0 0.5 TEMPERATURE (C) 70 65 1.5 2.0 2.5 3.0 FIGURE 12. ISL32600E, ISL32601E RECEIVER OUTPUT CURRENT vs RECEIVER OUTPUT VOLTAGE FIGURE 11. ISL32600E, ISL32601E DRIVER DIFFERENTIAL OUTPUT VOLTAGE vs TEMPERATURE RE = 0V 1.0 RECEIVER OUTPUT VOLTAGE (V) 10m RD = , CD = 50pF DE = VCC, RE = 0V VCC = 3.3V 256kbps 60 VCC = 3.0V 50 45 128kbps DE = VCC VCC = 2.7V ICC (A) ICC (A) 55 VCC = 3.3V 40 Tx AND Rx BOTH SWITCHING DE = 0V VCC = 3.0V 35 1m 9.6kbps VCC = 2.7V 30 -25 -10 5 20 35 50 65 80 95 100 2.7 110 125 2.8 DI 3 2 1 0 A-B -1 -2 RD = 3 2 1 0 TIME (10s/DIV) FIGURE 15. ISL32600E, ISL32601E PERFORMANCE WITH VCC = 3V, 256kbps, 3000ft (915m) CAT 5 CABLE FN7967 Rev.2.00 Jan 31, 2019 3.0 3.1 3.2 3.3 3.4 3.5 3.6 FIGURE 14. ISL32600E, ISL32601E DYNAMIC SUPPLY CURRENT vs SUPPLY VOLTAGE AT DIFFERENT DATA RATES 3 RECEIVER OUTPUT (V) RECEIVER INPUTS (V) RECEIVER OUTPUT (V) RECEIVER INPUTS (V) 0 DRIVER INPUT (V) FIGURE 13. ISL32600E, ISL32601E STATIC SUPPLY CURRENT vs TEMPERATURE 3 2.9 VCC (V) TEMPERATURE (C) DRIVER INPUT (V) 25 -40 0 DI 3 2 1 0 A-B -1 -2 RD = 3 2 1 0 TIME (20s/DIV) FIGURE 16. ISL32600E, ISL32601E PERFORMANCE WITH VCC = 2.7V, 128kbps, 4000ft (1220m) CAT 5 CABLE Page 13 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Performance Curves VCC = 3V (ISL32600E, ISL32601E) or 1.8V (ISL32602E, ISL32603E), TA = +25C; unless otherwise specified (Continued) 400 3.0 390 PROPAGATION DELAY (ns) RD = 54, CD = 50pF RD = 54, CD = 50pF 2.5 380 2.0 SKEW (ns) 370 360 1.5 1.0 350 tDDLH 0.5 340 tDDHL 330 -40 -25 -10 5 tSKEW = |tDDLH - tDDHL| 20 35 50 65 80 95 0 -40 110 125 -25 -10 5 TEMPERATURE (C) 20 35 50 65 80 95 110 125 TEMPERATURE (C) FIGURE 17. ISL32600E, ISL32601E DRIVER DIFFERENTIAL PROPAGATION DELAY vs TEMPERATURE FIGURE 18. ISL32600E, ISL32601E DRIVER DIFFERENTIAL SKEW vs TEMPERATURE 130 1000 128 950 126 124 850 SKEW (ns) 800 122 tPLH 750 120 118 116 700 tPHL 114 650 112 600 -40 -25 -10 5 20 35 50 65 80 95 110 DRIVER OUTPUT (V) 2 1 0 A/Y - B/Z -1 -2 TIME (200ns/DIV) FIGURE 21. ISL32600E, ISL32601E DRIVER AND RECEIVER WAVEFORMS, LOW TO HIGH FN7967 Rev.2.00 Jan 31, 2019 RECEIVER OUTPUT (V) 0 RO DRIVER INPUT (V) RECEIVER OUTPUT (V) DRIVER OUTPUT (V) 3 0 3 5 20 35 50 65 80 95 110 125 FIGURE 20. ISL32600E, ISL32601E RECEIVER SKEW vs TEMPERATURE FIGURE 19. ISL32600E, ISL32601E RECEIVER PROPAGATION DELAY vs TEMPERATURE DI -25 -10 TEMPERATURE (C) TEMPERATURE (C) RDIFF = 54, CD = 50pF tSKEW = |tPLH - tPHL| 110 -40 125 RDIFF = 54, CD = 50pF DI 3 0 3 0 RO 2 1 0 A/Y - B/Z -1 -2 TIME (200ns/DIV) FIGURE 22. ISL32600E, ISL32601E DRIVER AND RECEIVER WAVEFORMS, HIGH TO LOW Page 14 of 25 DRIVER INPUT (V) PROPAGATION DELAY (ns) 900 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Performance Curves VCC = 3V (ISL32600E, ISL32601E) or 1.8V (ISL32602E, ISL32603E), TA = +25C; unless otherwise specified (Continued) 140 200 120 -40C 150 +125C Y OR Z = LOW 50 0 Y OR Z = HIGH -50 +125C -100 OUTPUT CURRENT (mA) OUTPUT CURRENT (mA) +25C 100 100 -40C 80 +25C 60 Y OR Z = LOW +25C 20 -40C 0 +125C -20 +25C -40C -150 -7 -6 -5 -4 -3 -2 -1 0 1 2 3 4 5 6 7 8 9 10 11 12 -40 Y OR Z = HIGH -40C -7 -6 -5 -4 -3 -2 -1 0 1 2 3 4 5 6 7 FIGURE 23. ISL32600E, ISL32601E DRIVER OUTPUT CURRENT vs SHORT-CIRCUIT VOLTAGE FIGURE 24. ISL32602E, ISL32603E DRIVER OUTPUT CURRENT vs SHORT-CIRCUIT VOLTAGE 30 VCC = 3.3V, RDIFF = 100 2.3 2.1 VCC = 3.3V, RDIFF = 54 1.7 VCC = 1.8V, RDIFF = 10k 1.3 1.1 0.9 VCC = 1.8V, RDIFF = 100 0.7 -40 RECEIVER OUTPUT CURRENT (mA) DIFFERENTIAL OUTPUT VOLTAGE (V) 2.5 1.5 VOL, +25C 20 -10 5 20 35 50 65 80 95 VCC = 1.8V 0 VOL, +85C VOL, +25C VOL, +85C VOL, +125C 10 VOH, +25C, +85C, +125C VOH, +85C VOH, +125C -10 VCC = 3.3V -20 VOH, +25C -30 -25 VOL, +125C VCC = 3.3V 110 125 0 0.5 1.0 1.5 2.0 2.5 FIGURE 25. ISL32602E, ISL32603E DRIVER DIFFERENTIAL OUTPUT VOLTAGE vs TEMPERATURE RE = 0V Tx AND Rx BOTH SWITCHING RD = , CD = 50pF DE = VCC, RE = 0V 160 460kbps 10m 256kbps VCC = 3.3V, DE = VCC ICC (A) ICC (A) 3.3 FIGURE 26. ISL32602E, ISL32603E RECEIVER OUTPUT CURRENT vs RECEIVER OUTPUT VOLTAGE 100m 180 140 3.0 RECEIVER OUTPUT VOLTAGE (V) TEMPERATURE (C) 120 8 9 10 11 12 OUTPUT VOLTAGE (V) OUTPUT VOLTAGE (V) 1.9 +125C 40 VCC = 3.3V, DE = 0V VCC = 1.8V, DE = VCC 128kbps 1m 9.6kbps 100 100 80 60 -40 STATIC VCC = 1.8V, DE = 0V -25 -10 5 20 35 50 65 80 95 110 125 TEMPERATURE (C) FIGURE 27. ISL32602E, ISL32603E STATIC SUPPLY CURRENT vs TEMPERATURE FN7967 Rev.2.00 Jan 31, 2019 10 1.8 2.0 2.2 2.4 2.6 2.8 3.0 3.2 3.4 3.6 VCC (V) FIGURE 28. ISL32602E, ISL32603E DYNAMIC SUPPLY CURRENT vs SUPPLY VOLTAGE AT DIFFERENT DATA RATES Page 15 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Performance Curves VCC = 3V (ISL32600E, ISL32601E) or 1.8V (ISL32602E, ISL32603E), TA = +25C; unless A-B RD = 2.0 1.5 1.0 0.5 0 TIME (10s/DIV) FIGURE 29. ISL32602E, ISL32603E PERFORMANCE WITH VCC = 1.8V, 256kbps, 1000ft (305m) CAT 5 CABLE 1200 4 3 2 1 0 -1 -2 -3 A-B RD = 4 3 2 1 0 TIME (10s/DIV) CD = 50pF 120 tSKEW = |tDDLH - tDDHL| VCC = 1.8V, RD = 1000 100 800 SKEW (ns) 900 tDDHL 700 tDDLH 600 VCC = 1.8V, RD = 80 60 40 500 400 -25 -10 5 20 tDDHL VCC = 3.3V, RD = 54 300 -40 VCC = 3.3V, RD = 54 tDDLH 20 35 50 65 TEMPERATURE (C) 80 95 0 110 125 FIGURE 31. ISL32602E, ISL32603E DRIVER DIFFERENTIAL PROPAGATION DELAY vs TEMPERATURE -40 -25 -10 5 20 35 50 65 TEMPERATURE (C) 80 95 110 125 FIGURE 32. ISL32602E, ISL32603E DRIVER DIFFERENTIAL SKEW vs TEMPERATURE 300 140 tSKEW = |tPLH - tPHL| 280 120 260 100 240 220 SKEW (ns) PROPAGATION DELAY (ns) DI 0 FIGURE 30. ISL32602E, ISL32603E PERFORMANCE WITH VCC = 3.3V, 460kbps, 2000ft (610m) CAT 5 CABLE CD = 50pF 1100 PROPAGATION DELAY (ns) 3 DRIVER INPUT (V) 2.0 1.5 1.0 0.5 0 -0.5 -1.0 -1.5 DI RECEIVER OUTPUT (V) RECEIVER INPUTS (V) RECEIVER OUTPUT (V) RECEIVER INPUTS (V) 2 0 DRIVER INPUT (V) otherwise specified (Continued) VCC = 1.8V, tPLH 200 180 160 VCC = 1.8V 80 60 VCC = 1.8V, tPHL 140 VCC = 3.3V, tPLH 40 VCC = 3.3V, tPHL 20 120 100 -40 -25 -10 5 20 35 50 65 TEMPERATURE (C) 80 95 110 125 FIGURE 33. ISL32602E, ISL32603E RECEIVER PROPAGATION DELAY vs TEMPERATURE FN7967 Rev.2.00 Jan 31, 2019 0 -40 VCC = 3.3V -25 -10 5 20 35 50 65 TEMPERATURE (C) 80 95 110 125 FIGURE 34. ISL32602E, ISL32603E RECEIVER SKEW vs TEMPERATURE Page 16 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Typical Performance Curves VCC = 3V (ISL32600E, ISL32601E) or 1.8V (ISL32602E, ISL32603E), TA = +25C; unless 2 RO 0 DRIVER OUTPUT (V) DRIVER OUTPUT (V) 1.5 1.0 0.5 0 A/Y - B/Z -0.5 -1.0 -1.5 DI 2 0 RO 0 1.5 1.0 0.5 0 A/Y - B/Z -0.5 -1.0 -1.5 TIME (1s/DIV) TIME (1s/DIV) 0 3 RO 0 3 2 1 0 -1 RECEIVER OUTPUT (V) DI 3 DRIVER INPUT (V) RDIFF = 54, CD = 50pF FIGURE 36. ISL32602E, ISL32603E DRIVER AND RECEIVER WAVEFORMS, HIGH TO LOW DRIVER OUTPUT (V) DRIVER OUTPUT (V) RECEIVER OUTPUT (V) FIGURE 35. ISL32602E, ISL32603E DRIVER AND RECEIVER WAVEFORMS, LOW TO HIGH VCC = 3.3V A/Y - B/Z -2 -3 TIME (200ns/DIV) FIGURE 37. ISL32602E, ISL32603E DRIVER AND RECEIVER WAVEFORMS, LOW TO HIGH 2 DRIVER INPUT (V) 0 RDIFF = 10k, CD = 50pF VCC = 1.8V VCC = 3.3V RDIFF = 54, CD = 50pF DI 3 0 3 0 RO DRIVER INPUT (V) DI 2 RECEIVER OUTPUT (V) RDIFF = 10k, CD = 50pF VCC = 1.8V DRIVER INPUT (V) RECEIVER OUTPUT (V) otherwise specified (Continued) 3 2 1 0 -1 A/Y - B/Z -2 -3 TIME (200ns/DIV) FIGURE 38. ISL32602E, ISL32603E DRIVER AND RECEIVER WAVEFORMS, HIGH TO LOW Die Characteristics Application Information SUBSTRATE POTENTIAL (POWERED UP): RS-485 and RS-422 are differential (balanced) data transmission standards for use in long haul or noisy environments. RS-422 is a subset of RS-485, so RS-485 transceivers are also RS-422 compliant. RS-422 is a point-to-multipoint (multidrop) standard, which allows only one driver and up to 10 receivers on each bus, assuming one unit load devices. RS-485 is a true multipoint standard, which allows up to 32 one-unit load devices (any combination of drivers and receivers) on each bus. To allow for multipoint operation, the RS-485 specification requires that drivers must handle bus contention without sustaining any damage. GND PROCESS: Si Gate BiCMOS FN7967 Rev.2.00 Jan 31, 2019 Page 17 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Another important advantage of RS-485 is the extended Common-Mode Range (CMR), which specifies that the driver outputs and receiver inputs withstand signals that range from -7V to +12V. RS-422 and RS-485 are intended for runs as long as 4000ft, so the wide CMR is necessary to handle ground potential differences and voltages induced in the cable by external fields. Receiver Features RECEIVER OUTPUT (V) RECEIVER INPUT (V) The ISL3260xE devices use a differential input receiver for maximum noise immunity and common-mode rejection. Input sensitivity is greater than 200mV, as required by the RS-422 and RS-485 specifications. The symmetrical 200mV switching thresholds eliminate the duty cycle distortion that occurs on receivers with Full Fail Safe (FFS) functionality and with slowly transitioning input signals (see Figure 39). FFS receiver switching points have a negative offset, so the RO high time is naturally longer than the low time. The ISL3260xE's larger receiver input sensitivity range enables an increase of the receiver input hysteresis. The 40mV to 65mV receiver hysteresis increases the noise immunity, which is an advantage for noisy networks or networks with slow bus transitions. 1 A-B 0 pull-down on inverting input) to preserve the bus idle state when the bus is not actively driven. Receivers operate at data rates from 128kbps to 460kbps depending on the supply voltage, and all receiver outputs are tri-statable using the active low RE input. There are no parasitic diodes nor ESD diodes to VCC on the RE input, so RE is tolerant of input voltages up to 5.5V, even with the ISL3260xE powered down (VCC = 0V). Driver Features The ISL3260xE drivers are differential output devices that deliver at least 1.4V with VCC 3V across a 54 load (RS-485) and at least 1.95V with VCC 3.15V across a 100 load (RS-422). The 1.8V transmitters deliver a 1.1V unloaded, differential level. Drivers operate at data rates from 128kbps to 460kbps depending on the supply voltage, and they feature low propagation delay skews to maximize bit width. Driver outputs are slew rate limited to minimize EMI and to reduce reflections in unterminated or improperly terminated networks. All drivers are tri-statable using the active high DE input. There are no parasitic diodes nor ESD diodes to VCC on the DI and DE inputs, so these inputs are tolerant of input voltages up to 5.5V, even with the ISL3260xE powered down (VCC = 0V). 1.8V Operation -1 4 ISL3260xE 0 4 ISL3172E 0 VCC = 3.3V, DATA RATE = 125kbps TIME (4s/DIV) FIGURE 39. COMPARED WITH A FULL-FAILSAFE ISL3172E RECEIVER, THE SYMMETRICAL RX THRESHOLDS OF THE ISL3260xE DELIVER LESS OUTPUT DUTY CYCLE DISTORTION WHEN DRIVEN WITH SLOW INPUT SIGNALS The receiver input resistance of 96k surpasses the RS-422 specification of 4k and is eight times the RS-485 Unit Load (UL) requirement of 12k minimum. Therefore, these products are known as "one-eighth UL" transceivers and there can be up to 256 of these devices on a network while still complying with the RS-485 loading specification. Receiver inputs function with common-mode voltages as great as +9V/-7V outside the power supplies (that is, +12V and -7V) at VCC = 3V, making them ideal for long networks where induced voltages and ground potential differences are realistic concerns. The positive CMR is limited to +2V when the ISL32602E or ISL32603E is operated with VCC = 1.8V. All the receivers include a "fail-safe if open" function that assures a high level receiver output if the receiver inputs are unconnected (floating). Because the Rx is not FFS, terminated networks may require bus biasing resistors (pull-up on noninverting input, FN7967 Rev.2.00 Jan 31, 2019 The ISL32602E and ISL32603E are specifically designed to operate with supply voltages as low as 1.8V. Avoid termination resistors at this operating condition, and the unterminated driver is assured to deliver a healthy 1.1V differential output voltage. This low supply voltage limits the +CMR to +2V, but the CMR increases as VCC increases. For proper 1.8V operation, the ISL32602E and ISL32603E must run at a higher operating current. Therefore, their ICC with VCC = 3.3V is considerably higher than the ICC of the ISL32600E and ISL32601E, which are optimized for low ICC at 3.3V (see Figures 1 and 2). Hot Plug Function When a piece of equipment powers up, a period of time when the processor or ASIC driving the RS-485 control lines (DE, RE) is unable to ensure that the RS-485 Tx and Rx outputs are kept disabled. If the equipment is connected to the bus, a driver activating prematurely during power-up may crash the bus. To avoid this scenario, the ISL3260xE devices incorporate a hot plug function. During power-up, circuitry monitoring VCC ensures that the Tx and Rx outputs remain disabled for a period of time, regardless of the state of DE and RE. This gives the processor/ASIC a chance to stabilize and drive the RS-485 control lines to the proper states. ESD Protection All pins on the ISL3260xE devices include Class 3 (>8kV) Human Body Model (HBM) ESD protection structures, but the RS-485 pins (driver outputs and receiver inputs) incorporate advanced structures allowing them to survive ESD events in excess of 15kV HBM and 15kV IEC61000. The RS-485 pins are particularly vulnerable to ESD damage because they typically connect to an exposed port on the exterior of the finished product. Touching the port pins, or connecting a cable, can cause an ESD event that can destroy unprotected ICs. The new ESD structures protect the device Page 18 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E whether or not it is powered up without degrading the transceiver's CMR. The built-in ESD protection eliminates the need for board level protection structures such as transient suppression diodes and the associated undesirable capacitive load they present. IEC61000-4-2 Testing The IEC61000 test method applies to finished equipment, rather than to an individual IC. Therefore, the pins most likely to suffer an ESD event are those that are exposed to the outside world (the RS-485 pins in this case), the IC is tested in its typical application configuration (power applied) rather than testing each pin-to-pin combination. The lower current limiting resistor coupled with the larger charge storage capacitor yields a test that is much more severe than the HBM test. The extra ESD protection built into this device's RS-485 pins allows the design of equipment meeting Level 4 criteria without the need for additional board level protection on the RS-485 port. AIR-GAP DISCHARGE TEST METHOD For the air-gap discharge test method, a charged probe tip moves toward the IC pin until the voltage arcs to it. The current waveform delivered to the IC pin depends on approach speed, humidity, temperature, etc. so it is difficult to obtain repeatable results. The ISL3260xE RS-485 pins withstand 15kV air-gap discharges. CONTACT DISCHARGE TEST METHOD multi-receiver applications, keep stubs connecting receivers to the main cable as short as possible. Multipoint (multi-driver) systems require that the main cable be terminated in its characteristic impedance at both ends. Keep stubs connecting a transceiver to the main cable as short as possible. Terminated networks using the ISL3260xE may require bus biasing resistors (pull-up on noninverting input, pull-down on inverting input) to preserve the bus idle state when the bus is not actively driven. Without bus biasing, the termination resistor collapses the undriven, differential bus voltage to 0V, which is an undefined level to the ISL3260xE Rx. Bus biasing forces a few hundred mV positive differential voltage on the undriven bus, which all RS-485 and RS-422 Rx interpret as a valid logic high. Built-In Driver Overload Protection As stated previously, the RS-485 specification requires that drivers survive worst case bus contentions undamaged. These devices meet this requirement using driver output short-circuit current limits and on-chip thermal shutdown circuitry. The driver output stages incorporate short-circuit current limiting circuitry that ensures that the output current never exceeds the RS-485 specification, even at the common-mode voltage range extremes. Additionally, these devices use a foldback circuit which reduces the short-circuit current, and thus the power dissipation, whenever the contending voltage exceeds either supply. During the contact discharge test, the probe contacts the tested pin before the probe tip is energized, and eliminates the variables associated with the air-gap discharge. The result is a more repeatable and predictable test, but equipment limits prevent testing devices at voltages higher than 8kV. The ISL3260xE devices survive 8kV contact discharges on the RS-485 pins. In the event of a major short-circuit condition, the ISL3260xE's thermal shutdown feature disables the drivers whenever the die temperature becomes excessive. Thermal shutdown eliminates the power dissipation, allowing the die to cool. The drivers automatically re-enable after the die temperature drops by about 20C. If the condition persists, the thermal shutdown/re-enable cycle repeats until the fault is cleared. Receivers remain operational during thermal shutdown. Data Rate, Cables, and Terminations Low Power Shutdown Mode RS-485/422 are intended for network lengths up to 4000ft (1220m), but the maximum system data rate decreases as the transmission length increases. The ISL32600E and ISL32601E operate at data rates up to 128kbps at the maximum (4000ft) distance, or at data rates of 256kbps for cable lengths less than 3000ft (915m). The ISL32602E and ISL32603E, with VCC = 1.8V, are limited to 1000ft (305m) at 256kbps, or 2000ft (610m) at 128kbps. With VCC = 3.3V, the ISL32602E and ISL32603E deliver 460kbps over 2000ft, 256kbps over 3000ft, or 128kbps over 4000ft cables. These micro-power transceivers all use a fraction of the power required by their counterparts, but they also include a shutdown feature that reduces the already low quiescent ICC to a 10nA trickle. These devices enter shutdown whenever the receiver and driver are simultaneously disabled (RE = VCC and DE = GND) for a period of at least 600ns (1200ns at VCC = 1.8V). Disabling both the driver and the receiver for fewer than 50ns assures that the transceiver does not enter shutdown. Twisted pair is the cable of choice for RS-485 and RS-422 networks. Twisted pair cables tend to pick up noise and other electromagnetically induced voltages as common-mode signals that are effectively rejected by the differential receivers in these ICs. Note that most receiver and driver enable times increase when the transceiver enables from shutdown. See Notes 9 through 13 on page 10 for more information. Short networks using these transceivers need not be terminated, but terminations are recommended for 2.7V to 3.6V powered networks unless power dissipation is an overriding concern. Terminations are not recommended for 1.8V applications due to the low drive available from those transmitters. In point-to-point, or point-to-multipoint (single driver on bus) networks, terminate the main cable in its characteristic impedance (typically 120) at the end farthest from the driver. In FN7967 Rev.2.00 Jan 31, 2019 Page 19 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Revision History The revision history provided is for informational purposes only and is believed to be accurate, but not warranted. Please visit our website to make sure you have the latest revision. DATE REVISION CHANGE Jan 31, 2019 FN7967.2 Updated Figures 3 and 4. Updated ordering information table by adding all tape and reel parts and information and updating notes. Updated links throughout document. Removed About Intersil section. Updated disclaimer. Oct 20, 2017 FN7967.1 Added the Related Literature section. Updated the Truth Table on page 3. Applied Intersil A Renesas Company template. June 22, 2012 FN7967.0 Initial Release. FN7967 Rev.2.00 Jan 31, 2019 Page 20 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E Package Outline Drawings For the most recent package outline drawing, see M8.118. M8.118 8 LEAD MINI SMALL OUTLINE PLASTIC PACKAGE Rev 4, 7/11 5 3.00.05 A DETAIL "X" D 8 1.10 MAX SIDE VIEW 2 0.09 - 0.20 4.90.15 3.00.05 5 0.95 REF PIN# 1 ID 1 2 B 0.65 BSC GAUGE PLANE TOP VIEW 0.55 0.15 0.25 33 0.85010 H DETAIL "X" C SEATING PLANE 0.25 - 0.36 0.08 M C A-B D 0.10 0.05 0.10 C SIDE VIEW 1 (5.80) NOTES: (4.40) (3.00) 1. Dimensions are in millimeters. (0.65) (0.40) (1.40) TYPICAL RECOMMENDED LAND PATTERN FN7967 Rev.2.00 Jan 31, 2019 2. Dimensioning and tolerancing conform to JEDEC MO-187-AA and AMSEY14.5m-1994. 3. Plastic or metal protrusions of 0.15mm max per side are not included. 4. Plastic interlead protrusions of 0.15mm max per side are not included. 5. Dimensions are measured at Datum Plane "H". 6. Dimensions in ( ) are for reference only. Page 21 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E M8.15 For the most recent package outline drawing, see M8.15. 8 LEAD NARROW BODY SMALL OUTLINE PLASTIC PACKAGE Rev 4, 1/12 DETAIL "A" 1.27 (0.050) 0.40 (0.016) INDEX 6.20 (0.244) 5.80 (0.228) AREA 0.50 (0.20) x 45 0.25 (0.01) 4.00 (0.157) 3.80 (0.150) 1 2 8 0 3 0.25 (0.010) 0.19 (0.008) SIDE VIEW "B" TOP VIEW 2.20 (0.087) SEATING PLANE 5.00 (0.197) 4.80 (0.189) 1.75 (0.069) 1.35 (0.053) 1 8 2 7 0.60 (0.023) 1.27 (0.050) 3 6 4 5 -C- 1.27 (0.050) 0.25(0.010) 0.10(0.004) 0.51(0.020) 0.33(0.013) 5.20(0.205) SIDE VIEW "A TYPICAL RECOMMENDED LAND PATTERN NOTES: 1. Dimensioning and tolerancing per ANSI Y14.5M-1994. 2. Package length does not include mold flash, protrusions or gate burrs. Mold flash, protrusion and gate burrs shall not exceed 0.15mm (0.006 inch) per side. 3. Package width does not include interlead flash or protrusions. Interlead flash and protrusions shall not exceed 0.25mm (0.010 inch) per side. 4. The chamfer on the body is optional. If it is not present, a visual index feature must be located within the crosshatched area. 5. Terminal numbers are shown for reference only. 6. The lead width as measured 0.36mm (0.014 inch) or greater above the seating plane, shall not exceed a maximum value of 0.61mm (0.024 inch). 7. Controlling dimension: MILLIMETER. Converted inch dimensions are not necessarily exact. 8. This outline conforms to JEDEC publication MS-012-AA ISSUE C. FN7967 Rev.2.00 Jan 31, 2019 Page 22 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E M10.118 For the most recent package outline drawing, see M10.118. 10 LEAD MINI SMALL OUTLINE PLASTIC PACKAGE Rev 1, 4/12 5 3.00.05 A DETAIL "X" D 10 1.10 MAX SIDE VIEW 2 0.09 - 0.20 4.90.15 3.00.05 5 0.95 REF PIN# 1 ID 1 2 0.50 BSC B GAUGE PLANE TOP VIEW 0.55 0.15 0.25 33 0.85010 H DETAIL "X" C SEATING PLANE 0.18 - 0.27 0.08 M C A-B D 0.10 0.05 0.10 C SIDE VIEW 1 (5.80) NOTES: (4.40) (3.00) 1. Dimensions are in millimeters. 2. Dimensioning and tolerancing conform to JEDEC MO-187-BA and AMSEY14.5m-1994. 3. Plastic or metal protrusions of 0.15mm max per side are not included. 4. Plastic interlead protrusions of 0.15mm max per side are not included. (0.50) (0.29) (1.40) 5. Dimensions are measured at Datum Plane "H". 6. Dimensions in ( ) are for reference only. TYPICAL RECOMMENDED LAND PATTERN FN7967 Rev.2.00 Jan 31, 2019 Page 23 of 25 ISL32600E, ISL32601E, ISL32602E, ISL32603E M14.15 For the most recent package outline drawing, see M14.15. 14 LEAD NARROW BODY SMALL OUTLINE PLASTIC PACKAGE Rev 1, 10/09 8.65 A 3 4 0.10 C A-B 2X 6 14 DETAIL"A" 8 0.220.03 D 6.0 3.9 4 0.10 C D 2X 0.20 C 2X 7 PIN NO.1 ID MARK 5 0.31-0.51 B 3 (0.35) x 45 4 4 6 0.25 M C A-B D TOP VIEW 0.10 C 1.75 MAX H 1.25 MIN 0.25 GAUGE PLANE C SEATING PLANE 0.10 C 0.10-0.25 1.27 SIDE VIEW (1.27) DETAIL "A" (0.6) NOTES: 1. Dimensions are in millimeters. Dimensions in ( ) for Reference Only. 2. Dimensioning and tolerancing conform to AMSEY14.5m-1994. 3. Datums A and B to be determined at Datum H. (5.40) 4. Dimension does not include interlead flash or protrusions. Interlead flash or protrusions shall not exceed 0.25mm per side. 5. The pin #1 indentifier may be either a mold or mark feature. (1.50) 6. Does not include dambar protrusion. Allowable dambar protrusion shall be 0.10mm total in excess of lead width at maximum condition. 7. Reference to JEDEC MS-012-AB. TYPICAL RECOMMENDED LAND PATTERN FN7967 Rev.2.00 Jan 31, 2019 Page 24 of 25 1RWLFH 'HVFULSWLRQVRIFLUFXLWVVRIWZDUHDQGRWKHUUHODWHGLQIRUPDWLRQLQWKLVGRFXPHQWDUHSURYLGHGRQO\WRLOOXVWUDWHWKHRSHUDWLRQRIVHPLFRQGXFWRUSURGXFWV DQGDSSOLFDWLRQH[DPSOHV<RXDUHIXOO\UHVSRQVLEOHIRUWKHLQFRUSRUDWLRQRUDQ\RWKHUXVHRIWKHFLUFXLWVVRIWZDUHDQGLQIRUPDWLRQLQWKHGHVLJQRI\RXU SURGXFWRUV\VWHP5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\ORVVHVDQGGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPWKHXVHRI WKHVHFLUFXLWVVRIWZDUHRULQIRUPDWLRQ 5HQHVDV(OHFWURQLFVKHUHE\H[SUHVVO\GLVFODLPVDQ\ZDUUDQWLHVDJDLQVWDQGOLDELOLW\IRULQIULQJHPHQWRUDQ\RWKHUFODLPVLQYROYLQJSDWHQWVFRS\ULJKWVRU RWKHULQWHOOHFWXDOSURSHUW\ULJKWVRIWKLUGSDUWLHVE\RUDULVLQJIURPWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRUWHFKQLFDOLQIRUPDWLRQGHVFULEHGLQWKLV GRFXPHQWLQFOXGLQJEXWQRWOLPLWHGWRWKHSURGXFWGDWDGUDZLQJVFKDUWVSURJUDPVDOJRULWKPVDQGDSSOLFDWLRQH[DPSOHV 1ROLFHQVHH[SUHVVLPSOLHGRURWKHUZLVHLVJUDQWHGKHUHE\XQGHUDQ\SDWHQWVFRS\ULJKWVRURWKHULQWHOOHFWXDOSURSHUW\ULJKWVRI5HQHVDV(OHFWURQLFVRU RWKHUV <RXVKDOOQRWDOWHUPRGLI\FRS\RUUHYHUVHHQJLQHHUDQ\5HQHVDV(OHFWURQLFVSURGXFWZKHWKHULQZKROHRULQSDUW5HQHVDV(OHFWURQLFVGLVFODLPVDQ\ DQGDOOOLDELOLW\IRUDQ\ORVVHVRUGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPVXFKDOWHUDWLRQPRGLILFDWLRQFRS\LQJRUUHYHUVHHQJLQHHULQJ 5HQHVDV(OHFWURQLFVSURGXFWVDUHFODVVLILHGDFFRUGLQJWRWKHIROORZLQJWZRTXDOLW\JUDGHV6WDQGDUGDQG+LJK4XDOLW\7KHLQWHQGHGDSSOLFDWLRQVIRU HDFK5HQHVDV(OHFWURQLFVSURGXFWGHSHQGVRQWKHSURGXFW VTXDOLW\JUDGHDVLQGLFDWHGEHORZ 6WDQGDUG &RPSXWHUVRIILFHHTXLSPHQWFRPPXQLFDWLRQVHTXLSPHQWWHVWDQGPHDVXUHPHQWHTXLSPHQWDXGLRDQGYLVXDOHTXLSPHQWKRPH HOHFWURQLFDSSOLDQFHVPDFKLQHWRROVSHUVRQDOHOHFWURQLFHTXLSPHQWLQGXVWULDOURERWVHWF +LJK4XDOLW\ 7UDQVSRUWDWLRQHTXLSPHQWDXWRPRELOHVWUDLQVVKLSVHWF WUDIILFFRQWUROWUDIILFOLJKWV ODUJHVFDOHFRPPXQLFDWLRQHTXLSPHQWNH\ ILQDQFLDOWHUPLQDOV\VWHPVVDIHW\FRQWUROHTXLSPHQWHWF 8QOHVVH[SUHVVO\GHVLJQDWHGDVDKLJKUHOLDELOLW\SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV (OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWVDUHQRWLQWHQGHGRUDXWKRUL]HGIRUXVHLQSURGXFWVRUV\VWHPVWKDWPD\SRVHDGLUHFWWKUHDWWR KXPDQOLIHRUERGLO\LQMXU\DUWLILFLDOOLIHVXSSRUWGHYLFHVRUV\VWHPVVXUJLFDOLPSODQWDWLRQVHWF RUPD\FDXVHVHULRXVSURSHUW\GDPDJHVSDFHV\VWHP XQGHUVHDUHSHDWHUVQXFOHDUSRZHUFRQWUROV\VWHPVDLUFUDIWFRQWUROV\VWHPVNH\SODQWV\VWHPVPLOLWDU\HTXLSPHQWHWF 5HQHVDV(OHFWURQLFVGLVFODLPV DQ\DQGDOOOLDELOLW\IRUDQ\GDPDJHVRUORVVHVLQFXUUHGE\\RXRUDQ\WKLUGSDUWLHVDULVLQJIURPWKHXVHRIDQ\5HQHVDV(OHFWURQLFVSURGXFWWKDWLV LQFRQVLVWHQWZLWKDQ\5HQHVDV(OHFWURQLFVGDWDVKHHWXVHU VPDQXDORURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW :KHQXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVUHIHUWRWKHODWHVWSURGXFWLQIRUPDWLRQGDWDVKHHWVXVHU VPDQXDOVDSSOLFDWLRQQRWHV*HQHUDO1RWHVIRU +DQGOLQJDQG8VLQJ6HPLFRQGXFWRU'HYLFHVLQWKHUHOLDELOLW\KDQGERRNHWF DQGHQVXUHWKDWXVDJHFRQGLWLRQVDUHZLWKLQWKHUDQJHVVSHFLILHGE\ 5HQHVDV(OHFWURQLFVZLWKUHVSHFWWRPD[LPXPUDWLQJVRSHUDWLQJSRZHUVXSSO\YROWDJHUDQJHKHDWGLVVLSDWLRQFKDUDFWHULVWLFVLQVWDOODWLRQHWF5HQHVDV (OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\PDOIXQFWLRQVIDLOXUHRUDFFLGHQWDULVLQJRXWRIWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRXWVLGHRIVXFK VSHFLILHGUDQJHV $OWKRXJK5HQHVDV(OHFWURQLFVHQGHDYRUVWRLPSURYHWKHTXDOLW\DQGUHOLDELOLW\RI5HQHVDV(OHFWURQLFVSURGXFWVVHPLFRQGXFWRUSURGXFWVKDYHVSHFLILF FKDUDFWHULVWLFVVXFKDVWKHRFFXUUHQFHRIIDLOXUHDWDFHUWDLQUDWHDQGPDOIXQFWLRQVXQGHUFHUWDLQXVHFRQGLWLRQV8QOHVVGHVLJQDWHGDVDKLJKUHOLDELOLW\ SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWV DUHQRWVXEMHFWWRUDGLDWLRQUHVLVWDQFHGHVLJQ<RXDUHUHVSRQVLEOHIRULPSOHPHQWLQJVDIHW\PHDVXUHVWRJXDUGDJDLQVWWKHSRVVLELOLW\RIERGLO\LQMXU\ LQMXU\RUGDPDJHFDXVHGE\ILUHDQGRUGDQJHUWRWKHSXEOLFLQWKHHYHQWRIDIDLOXUHRUPDOIXQFWLRQRI5HQHVDV(OHFWURQLFVSURGXFWVVXFKDVVDIHW\ GHVLJQIRUKDUGZDUHDQGVRIWZDUHLQFOXGLQJEXWQRWOLPLWHGWRUHGXQGDQF\ILUHFRQWURODQGPDOIXQFWLRQSUHYHQWLRQDSSURSULDWHWUHDWPHQWIRUDJLQJ GHJUDGDWLRQRUDQ\RWKHUDSSURSULDWHPHDVXUHV%HFDXVHWKHHYDOXDWLRQRIPLFURFRPSXWHUVRIWZDUHDORQHLVYHU\GLIILFXOWDQGLPSUDFWLFDO\RXDUH UHVSRQVLEOHIRUHYDOXDWLQJWKHVDIHW\RIWKHILQDOSURGXFWVRUV\VWHPVPDQXIDFWXUHGE\\RX 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHIRUGHWDLOVDVWRHQYLURQPHQWDOPDWWHUVVXFKDVWKHHQYLURQPHQWDOFRPSDWLELOLW\RIHDFK5HQHVDV (OHFWURQLFVSURGXFW<RXDUHUHVSRQVLEOHIRUFDUHIXOO\DQGVXIILFLHQWO\LQYHVWLJDWLQJDSSOLFDEOHODZVDQGUHJXODWLRQVWKDWUHJXODWHWKHLQFOXVLRQRUXVHRI FRQWUROOHGVXEVWDQFHVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH(85R+6'LUHFWLYHDQGXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVLQFRPSOLDQFHZLWKDOOWKHVH DSSOLFDEOHODZVDQGUHJXODWLRQV5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUGDPDJHVRUORVVHVRFFXUULQJDVDUHVXOWRI\RXUQRQFRPSOLDQFH ZLWKDSSOLFDEOHODZVDQGUHJXODWLRQV 5HQHVDV(OHFWURQLFVSURGXFWVDQGWHFKQRORJLHVVKDOOQRWEHXVHGIRURULQFRUSRUDWHGLQWRDQ\SURGXFWVRUV\VWHPVZKRVHPDQXIDFWXUHXVHRUVDOHLV SURKLELWHGXQGHUDQ\DSSOLFDEOHGRPHVWLFRUIRUHLJQODZVRUUHJXODWLRQV<RXVKDOOFRPSO\ZLWKDQ\DSSOLFDEOHH[SRUWFRQWUROODZVDQGUHJXODWLRQV SURPXOJDWHGDQGDGPLQLVWHUHGE\WKHJRYHUQPHQWVRIDQ\FRXQWULHVDVVHUWLQJMXULVGLFWLRQRYHUWKHSDUWLHVRUWUDQVDFWLRQV ,WLVWKHUHVSRQVLELOLW\RIWKHEX\HURUGLVWULEXWRURI5HQHVDV(OHFWURQLFVSURGXFWVRUDQ\RWKHUSDUW\ZKRGLVWULEXWHVGLVSRVHVRIRURWKHUZLVHVHOOVRU WUDQVIHUVWKHSURGXFWWRDWKLUGSDUW\WRQRWLI\VXFKWKLUGSDUW\LQDGYDQFHRIWKHFRQWHQWVDQGFRQGLWLRQVVHWIRUWKLQWKLVGRFXPHQW 7KLVGRFXPHQWVKDOOQRWEHUHSULQWHGUHSURGXFHGRUGXSOLFDWHGLQDQ\IRUPLQZKROHRULQSDUWZLWKRXWSULRUZULWWHQFRQVHQWRI5HQHVDV(OHFWURQLFV 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHLI\RXKDYHDQ\TXHVWLRQVUHJDUGLQJWKHLQIRUPDWLRQFRQWDLQHGLQWKLVGRFXPHQWRU5HQHVDV (OHFWURQLFVSURGXFWV 1RWH 1RWH 5HQHVDV(OHFWURQLFVDVXVHGLQWKLVGRFXPHQWPHDQV5HQHVDV(OHFWURQLFV&RUSRUDWLRQDQGDOVRLQFOXGHVLWVGLUHFWO\RULQGLUHFWO\FRQWUROOHG VXEVLGLDULHV 5HQHVDV(OHFWURQLFVSURGXFWV PHDQVDQ\SURGXFWGHYHORSHGRUPDQXIDFWXUHGE\RUIRU5HQHVDV(OHFWURQLFV 5HY1RYHPEHU &RUSRUDWH+HDGTXDUWHUV &RQWDFW,QIRUPDWLRQ 72<268)25(6,$7R\RVX .RWRNX7RN\R-DSDQ TOYOSU FORESIA, 3-2-24 Toyosu, )RUIXUWKHULQIRUPDWLRQRQDSURGXFWWHFKQRORJ\WKHPRVWXSWRGDWH YHUVLRQRIDGRFXPHQWRU\RXUQHDUHVWVDOHVRIILFHSOHDVHYLVLW For further information on a product, technology, the most up-to-date Koto-ku, Tokyo 135-0061, Japan ZZZUHQHVDVFRP version of a document, or your nearest sales office, please visit: ZZZUHQHVDVFRPFRQWDFW Corporate Headquarters www.renesas.com Contact Information www.renesas.com/contact/ 7UDGHPDUNV Trademarks 5HQHVDVDQGWKH5HQHVDVORJRDUHWUDGHPDUNVRI5HQHVDV(OHFWURQLFV &RUSRUDWLRQ$OOWUDGHPDUNVDQGUHJLVWHUHGWUDGHPDUNVDUHWKHSURSHUW\ Renesas and the Renesas logo are trademarks of Renesas Electronics RIWKHLUUHVSHFWLYHRZQHUV Corporation. All trademarks and registered trademarks are the property of their respective owners. 5HQHVDV(OHFWURQLFV&RUSRUDWLRQ$OOULJKWVUHVHUYHG